PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 239aa    MW: 27292.9 Da    PI: 4.8569
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20433genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.93.6e-27113162352
    RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +++e +s+yF++pi++AA+eL+v+lTvLK++CR++GI+RWPhRk+k l
  EMT20433 113 RVLTFELVSQYFYMPITQAARELNVGLTVLKKKCRELGIPRWPHRKLKNL 162
               6699*******************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.4499182IPR003035RWP-RK domain
PfamPF020428.9E-22115161IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MDSNGEHSFW PYGPSVWHDS YLLEDEALLC SLPFLSFGCQ PLCSNSPAVA QSSSLQGELD  60
TSFDDDLLRC WEAIEQSDDS TEDSGKGLPL LCYGEESGAA SNAMRADRVR SERVLTFELV  120
SQYFYMPITQ AARELNVGLT VLKKKCRELG IPRWPHRKLK NLQTLINDVE VLQEAGKAND  180
GEQLRAMVEM LEQERRLLEQ RPYVELEEKT KRLRQACFKA SYKKRRLLVL EPGEASKYY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035091e-41AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
GenBankAP0035691e-41AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0149621e-41AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126141e-41CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694021.11e-114PREDICTED: protein RKD2-like
TrEMBLN1R1N71e-177N1R1N7_AEGTA; Uncharacterized protein
STRINGMLOC_59560.11e-115(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-38RWP-RK domain-containing protein